Safety data sheet. GHS / OSHA HCS 2012 format, 16 sections. Issued by Epic Peptides Lab for the catalogue items listed in Section 1.

Epic Peptides Lab

Safety data sheet · lyophilized powder, vial

Epic Peptides Lab · USA

Document number: PL-SDS-131
Revision: 1.0 · 2026-10-03

PNC-27

lyophilized powder, vial

1Identification

Product Identifier

PNC-27

Document Number

PL-SDS-131

Catalogue Items Covered

Id
16659
Name
PNC-27 10mg
Sku
PL-PNC27-10MG-VIAL
Id
16653
Name
PNC-27 5mg
Sku
PL-PNC27-5MG-VIAL

Recommended Use

Laboratory research use by trained personnel.

Restrictions On Use

Not for human or veterinary use.

Supplier / Distributor

Epic Peptides Lab, USA

Telephone

+1 (787) 468-5291

info@epicpeptideslab.com

2Hazard(s) identification

Classification: Not classified as hazardous under OSHA HCS 2012 (29 CFR 1910.1200) or UN GHS, on the basis of the supplier safety data sheets consulted.
Label Elements: No data available.
Signal Word: No data available.
Other Hazards: No data available.

3Composition / information on ingredients

Description

Lyophilized (freeze-dried) powder or cake in a sealed glass vial with a rubber stopper and aluminium crimp cap.

Composition

Name
PNC-27
Full
p53(12–26) fused to a membrane-residency peptide
Cas
1159861-00-3
Formula
C188H293N53O44S
Conc
≥ 95% (dry basis, as supplied)
Qty
5 mg, 10 mg per vial

4First-aid measures

First Aid Measures

Inhalation: Move the person to fresh air and keep comfortable for breathing. If breathing is difficult or symptoms persist, call a POISON CENTER or doctor.
Skin: Take off contaminated clothing. Wash the skin with plenty of soap and water. If irritation or a rash develops, get medical advice.
Eyes: Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do; continue rinsing. If eye irritation persists, get medical advice.
Ingestion: Rinse mouth. Do not induce vomiting. Call a POISON CENTER or doctor if you feel unwell.

Most Important Symptoms And Effects

No specific symptoms are known. Pharmacologically active material: systemic effects consistent with its mechanism of action are possible after accidental injection, ingestion or absorption.

Likely Routes Of Exposure

Inhalation of dust, skin and eye contact when the vial is opened or the powder is weighed; ingestion through contaminated hands; accidental injection when reconstituted solutions are drawn into syringes.

5Fire-fighting measures

Fire Fighting Information: Combustible organic solid; finely divided powder may form dust clouds. Not flammable in the quantities supplied.

6Accidental release measures

Spill And Clean Up Procedures: Avoid dust formation. Dampen spilled powder with water, wipe up with absorbent material, place in a sealed container for disposal and clean the area with water and detergent.

7Handling and storage

Safe Handling: Open vials only in a clean area. Avoid generating or inhaling dust; weigh or reconstitute inside a ventilated enclosure when the full contents are handled as a dry powder. Reconstitute by adding diluent slowly to the vial wall; do not shake. Wash hands after handling.
Safe Storage: Store the sealed vial at the temperature stated in Section 9 (typically −20 °C for peptides, 2–8 °C for proteins), desiccated and protected from light. Allow the vial to reach room temperature before opening to avoid condensation. Reconstituted solutions: 2–8 °C, protected from light; use within the period established by your laboratory.
Storage Temperature: −20 °C (sealed vial), desiccated and protected from light; 2–8 °C acceptable for short periods
Incompatible Materials: Heat and moisture

8Exposure controls / personal protection

Occupational Exposure Limits: No data available.
Exposure Controls And PPE: No data available.

9Physical and chemical properties

Physical State

Solid

Appearance

White to off-white lyophilized powder

Properties

Odor: Little to none
Ph: Not applicable (solid); aqueous solutions typically pH 4–7
Melting: Not available
Boiling: Not available
Flash: Not applicable (non-flammable solid); combustible organic material
Vapour: Negligible (solid)
Density: No data available (bulk density of lyophilized cake is low)
Solubility: Reconstitute in sterile water at >= 100 ug/mL (ProSpec); soluble in water
Logp: Not available
Decomp: No data available; peptides decompose above about 200 °C
Other: 32-residue peptide, C188H293N53O44S, MW 4031.7; sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG; lyophilized with no additives (ProSpec)

10Stability and reactivity

Stability And Reactivity

Reactivity: Stable under recommended transport and storage conditions
Incompatible: Heat and moisture; strong acids/alkalis; strong oxidizing/reducing agents
Decomposition: In combustion may emit toxic fumes (carbon oxides, nitrogen oxides, sulfur oxides)
Conditions To Avoid: Heat, moisture, repeated freeze-thaw; store desiccated below -18 C

Conditions To Avoid

Heat, moisture, repeated freeze-thaw; store desiccated below -18 C

Incompatible Materials

Heat and moisture

11Toxicological information

Toxicological Information: Acute toxicity, oral
No data available

Acute toxicity, dermal
No data available

Acute toxicity, inhalation
No data available

Skin corrosion/irritation
No data available

Serious eye damage/irritation
No data available

Respiratory or skin sensitisation
No data available

Germ cell mutagenicity
No data available

Carcinogenicity
No data available; not listed by IARC

Reproductive toxicity
No data available

STOT, single exposure
No data available

STOT, repeated exposure
No data available

Aspiration hazard
No data available
Routes Of Exposure: Inhalation of dust, skin and eye contact when the vial is opened or the powder is weighed; ingestion through contaminated hands; accidental injection when reconstituted solutions are drawn into syringes.
Symptoms: No specific symptoms are known. Pharmacologically active material: systemic effects consistent with its mechanism of action are possible after accidental injection, ingestion or absorption.

12Ecological information

Ecological Information: No ecotoxicity, biodegradability, bioaccumulation or soil-mobility data (ProSpec).

13Disposal considerations

Disposal Guidance: No data available.

14Transport information

Transport Classification

Note: Not regulated as a dangerous good for transport by road (DOT 49 CFR), air (IATA/ICAO) or sea (IMDG). Not a marine pollutant. Ship refrigerated or frozen as required by Section 7; the coolant (dry ice, UN 1845) is regulated when used.

15Regulatory information

Regulatory Information

Tsca: Not applicable / not listed
Carcinogen Listings: None
Dea: Not a controlled substance
Other: SARA 313/311/312, CERCLA, Prop 65: not applicable. Transport: non-hazardous. Not WADA prohibited.

Carcinogen Listings

No data available.

16Other information

Revision: October 3, 2026
Sources Consulted: ProSpec-Tany TechnoGene

MedChemExpress

ChemicalBook
Confidence: medium
Additional Information: Lyophilised synthetic 32-residue peptide. Inhalation of protein dusts can sensitise susceptible individuals; avoid generating dust and handle the dry powder in a ventilated enclosure. Not classified for respiratory sensitisation because no substance-specific data exist.

Back to SDS list